PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo16G0012200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 730aa    MW: 76047.6 Da    PI: 5.8111
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo16G0012200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS263.76.2e-813697281374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      lv++L+++Ae+v++g+++ a+ +Larl+++ s++g+p+ R a+y +eAL++ + +       + +p  +++ +++ +l+a+k fsevsP+l+f+
  Spipo16G0012200 369 LVDQLFKAAEMVEAGNFTSARGILARLNHQLSQNGKPLVRSAFYCMEALQSIVGGAAAPG--SSSPALSTPLDVVLKLSAYKSFSEVSPVLQFA 460
                      6899*************************************************9933333..33455555567********************* PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp......egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                      ++t+ qa+le+++g++r+Hi+Df+++ G+QW +++q+La+R+      +gppslRiT+++sp+    ++ +++ e+L++fA el++pfe+++  
  Spipo16G0012200 461 NFTCAQALLEELSGCDRIHIVDFEVGVGGQWSSFMQELAQRRggggaaAGPPSLRITVFASPQ--PITRSSSLSENLSNFAGELNIPFEISI-- 550
                      ******************************************66555555***********88..899999********************9.. PP

             GRAS 183 akrledleleeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFlerflealeyysalfdsl 271
                       +++e++++ ++   v+++Ea+aVnl  +l        s++    ++L+lvk+l P++vv v++ a     ++ ++  r++++l+  ++l+ds+
  Spipo16G0012200 551 -QSIESVDPGSFleMVRRDEAVAVNLPASLGPSS----STPA---SLLRLVKQLAPRIVVSVDHGAAAaaaSDLPLPGRLFHTLQSGAVLLDSI 636
                      .78999999887656778**********877665....4444...79*****************96552236679******************* PP

             GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                      +a  + + ++++k+ + l++++i+++v  ++++           +  + +aGF+p++ls++a++qa++ll++ ++ g++ve+++++l+l+W++ 
  Spipo16G0012200 637 AAA-GVHPDAMNKMGHYLVKPRIESAVVGRHRA-----A-----SGDFAAAGFSPAALSSFAETQADCLLKRLQVSGFHVEKNQAALTLCWRRA 719
                      666.4577999****************987776.....2.....4679********************************************** PP

             GRAS 366 pLvsvSaWr 374
                      +L+sv aWr
  Spipo16G0012200 720 ELISVAAWR 728
                      ********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.173343708IPR005202Transcription factor GRAS
PfamPF035142.1E-78369728IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MRGTPFNLQG EEVLWKSTAA VGAPGSADSG DSVGTGKKER TEPRSVLDHR RSPSPPTSAS  60
TGGGSADSAG VAAVSDNPGR KWSPTTSLIA APDEAPGRRD EWAAAELLPI PTGLEIAALD  120
WDAMLCETAP PPPGHDQTSF LRFMMGEVDG FSAGAPKQRH HHHHQMLSQQ AAAEFEVGGG  180
DAAGGGAGIV DPVLGFENYP GMGLPGSMAA YPLSSSASYG SFGGFSTTKG DGETRFQPMS  240
PANSAHLRVP WFGANANPSP LSSPSPSPSP ASSFPFPLSL PPGGGFFTEP ATEEKLHLFG  300
PGLLLNQQQL QQSPPPPPLQ CAAFFPPLQP PFQEDMESSQ GPPGFHNLLQ IPTKSRSSPA  360
EEAATAAALV DQLFKAAEMV EAGNFTSARG ILARLNHQLS QNGKPLVRSA FYCMEALQSI  420
VGGAAAPGSS SPALSTPLDV VLKLSAYKSF SEVSPVLQFA NFTCAQALLE ELSGCDRIHI  480
VDFEVGVGGQ WSSFMQELAQ RRGGGGAAAG PPSLRITVFA SPQPITRSSS LSENLSNFAG  540
ELNIPFEISI QSIESVDPGS FLEMVRRDEA VAVNLPASLG PSSSTPASLL RLVKQLAPRI  600
VVSVDHGAAA AAASDLPLPG RLFHTLQSGA VLLDSIAAAG VHPDAMNKMG HYLVKPRIES  660
AVVGRHRAAS GDFAAAGFSP AALSSFAETQ ADCLLKRLQV SGFHVEKNQA ALTLCWRRAE  720
LISVAAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2639272826375GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411560.11e-153PREDICTED: scarecrow-like protein 27
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20203796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.19e-77GRAS family protein